You have no items in your shopping cart.
Cart summary
KLKB1 Protein, Rat, Recombinant (E. coli, His)
Catalog Number: orb1976569
| Catalog Number | orb1976569 |
|---|---|
| Category | Proteins |
| Description | The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. KLKB1 Protein, Rat, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.8 kDa and the accession number is P14272. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 31.8 kDa (predicted) |
| UniProt ID | P14272 |
| Protein Sequence | IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA |
| Expression System | E. coli |
| Biological Origin | Rat |
| Biological Activity | The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. KLKB1 Protein, Rat, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.8 kDa and the accession number is P14272. |
| Expression Region | 391-638 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
