KLK6 monoclonal antibody (M01), clone 4A10

• Catalog Number: orb2292328
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant KLK6.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: KLK6 (AAH15525, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: RAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGK
• Tested applications: ELISA, WB
• Clone Number: 4A10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH15525

Detection limit for recombinant GST tagged KLK6 is approximately 0.3 ng/ml as a capture antibody.

Western Blot analysis of KLK6 expression in transfected 293T cell line by KLK6 monoclonal antibody (M01), clone 4A10. Lane 1: KLK6 transfected lysate (26.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).