KLF8 monoclonal antibody (M12), clone 3F10

• Catalog Number: orb2291411
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant KLF8.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: KLF8 (NP_009181.1, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPL
• Tested applications: ELISA, WB
• Clone Number: 3F10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_009181.1

Detection limit for recombinant GST tagged KLF8 is 0.03 ng/ml as a capture antibody.

Western Blot analysis of KLF8 expression in transfected 293T cell line by KLF8 monoclonal antibody (M12), clone 3F10. Lane 1: KLF8 transfected lysate(39.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.52 KDa).