KLF2 Antibody (N-Terminus)

• Catalog Number: orb1538606
• Category: Antibodies
• Description: KLF2 Antibody (N-Terminus)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-P, WB
• Reactivity: Mouse
• Immunogen: Synthetic peptide from N-Terminus of mouse Klf2 (Q60843, NP_032478) within the region MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM. Percent identity by BLAST analysis: Mouse, Zebra finch, Chicken (100%); Marmoset, Rat, Opossum (92%); Human, Gibbon, Galago, Pig (85%); Xenopus (83%).
• Concentration: 0.5 mg/ml
• Dilution range: IHC, IHC-P (5 µg/ml), WB (0.2 - 1 µg/ml)
• Conjugation: Unconjugated
• Target: KLF2
• Storage: Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.
• Buffer/Preservatives: PBS, 0.09% sodium azide, 2% sucrose. PBS, 0.09% sodium azide, 2% sucrose
• Alternative names: KLF2, Krueppel-like factor 2, Kruppel-like factor
• Note: For research use only
• Application notes: Further information: Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as secondary antibody.
• Expiration Date: 12 months from date of receipt.