You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291887 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant KLF11. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 10D8 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003588 |
Immunofluorescence of monoclonal antibody to KLF11 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to KLF11 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
KLF11 monoclonal antibody (M03), clone 10D8. Western Blot analysis of KLF11 expression in K-562.
KLF11 monoclonal antibody (M03), clone 10D8. Western Blot analysis of KLF11 expression in PC-12.
KLF11 monoclonal antibody (M03), clone 10D8. Western Blot analysis of KLF11 expression in Raw 264.7.
Western Blot analysis of KLF11 expression in transfected 293T cell line by KLF11 monoclonal antibody (M03), clone 10D8. Lane 1: KLF11 transfected lysate (Predicted MW: 55.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.73 KDa).