KLF11 monoclonal antibody (M02), clone 10C5

• Catalog Number: orb2291888
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant KLF11.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 10C5
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
• NCBI: NP_003588
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

KLF11 monoclonal antibody (M02), clone 10C5 Western Blot analysis of KLF11 expression in Hela S3 NE.

KLF11 monoclonal antibody (M02), clone 10C5. Western Blot analysis of KLF11 expression in NIH/3T3.

Western Blot detection against Immunogen (37.73 KDa).