Cart summary

You have no items in your shopping cart.

KIRREL3 Peptide - C-terminal region

KIRREL3 Peptide - C-terminal region

Catalog Number: orb2001201

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2001201
CategoryProteins
DescriptionKIRREL3 Peptide - C-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: TQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSRPLQRRM
UniProt IDQ8IZU9
MW85 kDa
Tested applicationsWB
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesMRD4, KIRRE, NEPH2, PRO4502
NoteFor research use only
NCBINP_001155179.1