Kininogen 1/KNG1 Antibody

• Catalog Number: orb315163
• Category: Antibodies
• Description: Kininogen 1/KNG1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Mouse
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, By Heat Western blot, 0.1-0.5μg/ml, Mouse
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 73102 MW
• UniProt ID: O08677
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Kininogen-1;Kininogen-1 heavy chain;Bradykinin;Kin
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Kininogen 1 using anti-Kininogen 1 antibody.Lane 1:Mouse Lung Tissue;2:Mouse Testis Tissue;3:Mouse Liver Tissue;4:HEPA Cell;5:NEURO Cell.

IHC analysis of Kininogen 1 using anti-Kininogen 1 antibody. Kininogen 1 was detected in a paraffin-embedded section of mouse kidney tissue.