KIF2C monoclonal antibody (M01), clone 1G2

• Catalog Number: orb2291463
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant KIF2C.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: KIF2C (AAH14924, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI
• Tested applications: ELISA, IF, IHC-P, IP, WB
• Clone Number: 1G2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH14924

Western Blot detection against Immunogen (36.63 KDa).

Detection limit for recombinant GST tagged KIF2C is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to KIF2C on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]

Immunoprecipitation of KIF2C transfected lysate using anti-KIF2C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KIF2C MaxPab rabbit polyclonal antibody.

KIF2C monoclonal antibody (M01), clone 1G2 Western Blot analysis of KIF2C expression in Hela S3 NE.

Western Blot analysis of KIF2C expression in transfected 293T cell line by KIF2C monoclonal antibody (M01), clone 1G2. Lane 1: KIF2C transfected lysate(81.3 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of KIF2C over-expressed 293 cell line, cotransfected with KIF2C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KIF2C monoclonal antibody (M01), clone 1G2 (Cat # orb2291463). GAPDH (36.1 kDa) used as specificity and loading control.