You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291669 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant KIAA0101. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3C11-1F11 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | KIAA0101 (AAH05832, 1 a.a. ~ 111 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE |
NCBI | AAH05832 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged KIAA0101 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to KIAA0101 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to KIAA0101 on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (37.95 KDa).