KDM5B/PLU1/Jarid1B Antibody

• Catalog Number: orb381075
• Category: Antibodies
• Description: KDM5B/PLU1/Jarid1B Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Hamster, Rabbit
• Reactivity: Human, Monkey, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat, Monkey Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 175658 MW
• UniProt ID: Q9UGL1
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Lysine-specific demethylase 5B;1.14.11.-;Cancer/te
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U20S cells using anti-KDM5B antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of KDM5B using anti-KDM5B antibody.Lane 1:monkey COS-7 cell; 2:human SH-SY5Y cell; 3:rat testis tissue; 4:mouse testis tissue.

IF analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in immunocytochemical section of MCF-7 cells.

IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of human breast cancer tissue.

IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of mouse testis tissue.

IHC analysis of KDM5B using anti-KDM5B antibody. KDM5B was detected in paraffin-embedded section of rat testis tissue.