KCNQ1 Antibody

• Catalog Number: orb389421
• Category: Antibodies
• Description: KCNQ1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human KCNQ1 (356-397aa QQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIR), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 74699 MW
• UniProt ID: P51787
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Potassium voltage-gated channel subfamily KQT memb
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U937 cells using anti-KCNQ1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

WB analysis of KCNQ1 using anti-KCNQ1 antibody.Lane 1:human THP-1 cell; 2:rat stomach tissue; 3:rat lung tissue; 4:rat PC-12 cell; 5:mouse stomach tissue; 6:mouse lung tissue; 7:mouse NIH/3T3 cell.

IF analysis of KCNQ1 using anti-KCNQ1 antibody. KCNQ1 was detected in an immunocytochemical section of HeLa cells.

IHC analysis of KCNQ1 using anti-KCNQ1 antibody. KCNQ1 was detected in a paraffin-embedded section of human liver cancer tissue.

IHC analysis of KCNQ1 using anti-KCNQ1 antibody. KCNQ1 was detected in a paraffin-embedded section of human lung cancer tissue.

IHC analysis of KCNQ1 using anti-KCNQ1 antibody. KCNQ1 was detected in a paraffin-embedded section of human placenta tissue.

IHC analysis of KCNQ1 using anti-KCNQ1 antibody. KCNQ1 was detected in a paraffin-embedded section of human breast cancer tissue.