KCNK1 Rabbit Polyclonal Antibody

• Catalog Number: orb575368
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNK1
• Target: KCNK1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNK1
• Protein Sequence: Synthetic peptide located within the following region: EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
• UniProt ID: O00180
• MW: 38kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DPK, HOHO, K2P1, KCNO1, TWIK1, K2p1.1, TWIK-1
• Research Area: Cell Biology, Pharmacology & Drug Discovery, Signa
• Note: For research use only
• NCBI: NP_002236

WB Suggested Anti-KCNK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human heart.