You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292690 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant KCNC3. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1C1 |
Tested applications | ELISA, IF, WB |
Reactivity | Human, Mouse |
Isotype | IgG1 Kappa |
Immunogen | KCNC3 (NP_004968, 671 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP |
NCBI | NP_004968 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunofluorescence of monoclonal antibody to KCNC3 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
KCNC3 monoclonal antibody (M01), clone 1C1 Western Blot analysis of KCNC3 expression in NIH/3T3.
Western Blot detection against Immunogen (35.31 KDa).