KChIP2/KCNIP2 Antibody

• Catalog Number: orb315160
• Category: Antibodies
• Description: KChIP2/KCNIP2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Gallus
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, RatImmunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 30907 MW
• UniProt ID: Q9NS61
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Kv channel-interacting protein 2;KChIP2 ;A-type po
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of K562 cells using anti-KChIP2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of KCNA5 using anti-KCNA5 antibody.Lane 1:Rat Brain Tissue;2:Rat Cardiac Muscle Tissue;3:Mouse Cardiac Muscle Tissue;4:22RV1 Cell.

IF analysis of KChIP2 using anti-KChIP2 antibody. KChIP2 was detected in immunocytochemical section of SH-SY5Y cells.

IHC analysis of KCNA5 using anti-KCNA5 antibody. KCNA5 was detected in a paraffin-embedded section of mouse brain tissue.

IHC analysis of KCNA5 using anti-KCNA5 antibody. KCNA5 was detected in a paraffin-embedded section of human glioma tissue.

IHC analysis of KCNA5 using anti-KCNA5 antibody. KCNA5 was detected in a paraffin-embedded section of rat brain tissue.