You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb315160 |
---|---|
Category | Antibodies |
Description | KChIP2/KCNIP2 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Gallus |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Mouse, RatImmunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 30907 MW |
UniProt ID | Q9NS61 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Kv channel-interacting protein 2;KChIP2 ;A-type po Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of K562 cells using anti-KChIP2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of KCNA5 using anti-KCNA5 antibody.Lane 1:Rat Brain Tissue;2:Rat Cardiac Muscle Tissue;3:Mouse Cardiac Muscle Tissue;4:22RV1 Cell.
IF analysis of KChIP2 using anti-KChIP2 antibody. KChIP2 was detected in immunocytochemical section of SH-SY5Y cells.
IHC analysis of KCNA5 using anti-KCNA5 antibody. KCNA5 was detected in a paraffin-embedded section of mouse brain tissue.
IHC analysis of KCNA5 using anti-KCNA5 antibody. KCNA5 was detected in a paraffin-embedded section of human glioma tissue.
IHC analysis of KCNA5 using anti-KCNA5 antibody. KCNA5 was detected in a paraffin-embedded section of rat brain tissue.
Filter by Rating