Cart summary

You have no items in your shopping cart.

KAT6A Peptide - N-terminal region

KAT6A Peptide - N-terminal region

Catalog Number: orb2000344

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2000344
CategoryProteins
DescriptionKAT6A Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: GLDRKTVLEQLELSVKDGTILKVSNKGLNSYKDPDNPGRIALPKPRNHGK
UniProt IDA5PLL3
MW89 kDa
Application notesThis is a synthetic peptide designed for use in combination with KAT6A Rabbit Polyclonal Antibody (orb589344). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesMOZ, MRD32, MYST3, MYST-3, ZNF220, RUNXBP2, ZC2HC6
Read more...
NoteFor research use only
NCBINP_006757.2