ITGB8 monoclonal antibody (M01), clone 2B4

• Catalog Number: orb2292698
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ITGB8.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B4
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ITGB8 (NP_002205, 392 a.a. ~ 503 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDE
• NCBI: NP_002205
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ITGB8 is 0.3 ng/ml as a capture antibody.

Immunoprecipitation of ITGB8 transfected lysate using anti-ITGB8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ITGB8 MaxPab rabbit polyclonal antibody.

Western Blot analysis of ITGB8 expression in transfected 293T cell line by ITGB8 monoclonal antibody (M01), clone 2B4. Lane 1: ITGB8 transfected lysate (85.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (38.06 KDa).