ITGB5 monoclonal antibody (M01), clone 2C4

• Catalog Number: orb2292699
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ITGB5.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ITGB5 (NP_002204, 421 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA
• Tested applications: ELISA, WB
• Clone Number: 2C4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_002204

Detection limit for recombinant GST tagged ITGB5 is approximately 0.3 ng/ml as a capture antibody.

ITGB5 monoclonal antibody (M01), clone 2C4 Western Blot analysis of ITGB5 expression in HeLa.

Western Blot analysis of ITGB5 expression in transfected 293T cell line by ITGB5 monoclonal antibody (M01), clone 2C4. Lane 1: ITGB5 transfected lysate (88.1 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of ITGB5 over-expressed 293 cell line, cotransfected with ITGB5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ITGB5 monoclonal antibody (M01), clone 2C4 (Cat # orb2292699). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.3 KDa).