ITGA2 monoclonal antibody (M01), clone 2B6

• Catalog Number: orb2292705
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ITGA2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
• Tested applications: ELISA, IF, WB
• Clone Number: 2B6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_002194.2
• Expiration Date: 12 months from date of receipt.

ITGA2 monoclonal antibody (M01), clone 2B6 Western Blot analysis of ITGA2 expression in A-431.

Detection limit for recombinant GST tagged ITGA2 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ITGA2 on A-431 cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (35.53 KDa).