Cart summary

You have no items in your shopping cart.

    Isocitrate dehydrogenase/IDH1 Antibody

    Catalog Number: orb312127

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb312127
    CategoryAntibodies
    DescriptionIsocitrate dehydrogenase/IDH1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, IHC-Fr, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW46659 MW
    UniProt IDO75874
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesIsocitrate dehydrogenase [NADP] cytoplasmic;IDH;1.
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Isocitrate dehydrogenase/IDH1 Antibody

    Flow Cytometry analysis of HepG2 cells using anti-IDH1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Isocitrate dehydrogenase/IDH1 Antibody

    WB analysis of IDH1 using anti-IDH1 antibody.Lane 1:Rat Lung Tissue;2:Rat Kidney Tissue;3:Rat Brain Tissue;4:HELA Cell;5:SMMC Cell;6:A549 Cell;7:NIH3T3 Cell.

    Isocitrate dehydrogenase/IDH1 Antibody

    IHC analysis of IDH1 using anti-IDH1 antibody.IDH1 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue.

    Isocitrate dehydrogenase/IDH1 Antibody

    IHC analysis of IDH1 using anti-IDH1 antibody.IDH1 was detected in paraffin-embedded section of Mouse Testis Tissue.

    Isocitrate dehydrogenase/IDH1 Antibody

    IHC analysis of IDH1 using anti-IDH1 antibody.IDH1 was detected in paraffin-embedded section of Rat Testis Tissue.

    Isocitrate dehydrogenase/IDH1 Antibody

    IHC analysis of IDH1 using anti-IDH1 antibody.IDH1 was detected in frozen section of rat small intestine tissue.

    Isocitrate dehydrogenase/IDH1 Antibody

    IHC analysis of IDH1 using anti-IDH1 antibody.IDH1 was detected in immunocytochemical section of A549 cell.

    • IDH1 Antibody / Isocitrate Dehydrogenase [orb749585]

      IF,  IHC-P

      Human

      Mouse

      Monoclonal

      Unconjugated

      100 μg, 20 μg
    • Isocitrate dehydrogenase (IDH1) antibody [orb1319266]

      IHC,  WB

      Canine, Human, Monkey, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • Isocitrate dehydrogenase (IDH1) antibody [orb1319267]

      IHC,  WB

      Canine, Human, Monkey, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • Isocitrate dehydrogenase (IDH1) antibody [orb1319280]

      IHC,  WB

      Canine, Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • Isocitrate dehydrogenase (IDH1) antibody [orb1325305]

      IF,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars