You have no items in your shopping cart.
Cart summary
Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (E. coli, His)
Catalog Number: orb1979632
| Catalog Number | orb1979632 |
|---|---|
| Category | Proteins |
| Description | Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 23.8 kDa and the accession number is P15696. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 23.8 kDa (predicted) |
| UniProt ID | P15696 |
| Protein Sequence | CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL |
| Expression System | E. coli |
| Biological Origin | Bovine |
| Biological Activity | Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 23.8 kDa and the accession number is P15696. |
| Expression Region | 24-195 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
