You have no items in your shopping cart.
Cart summary
INS1 Recombinant Protein (Mouse)
Catalog Number: orb2050909
| Catalog Number | orb2050909 |
|---|---|
| Category | Proteins |
| Description | INS1 Recombinant Protein (Mouse) |
| Tag | N-terminal 6xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 13 kDa |
| UniProt ID | P01325 |
| Protein Sequence | FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN |
| Source | Yeast |
| NCBI | NP_032412 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | Ins-1;Ins2-rs1;insulin-1. Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Mouse Ins1 protein [orb54593]
Greater than 90% as determined by SDS-PAGE.
13 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgMouse INS1 protein [orb419058]
Greater than 90% as determined by SDS-PAGE.
14.5 kDa
E.coli
20 μg, 100 μg, 1 mgINS1 Recombinant Protein (Mouse) [orb2050907]
Greater than 90% as determined by SDS-PAGE.
13 kDa
Yeast
500 μgINS1 Recombinant Protein (Mouse) [orb2050908]
Greater than 90% as determined by SDS-PAGE.
13 kDa
Yeast
20 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
