Cart summary

You have no items in your shopping cart.

SLC10A1 Rabbit Polyclonal Antibody

SKU: orb578335

Description

Rabbit polyclonal antibody to SLC10A1

Research Area

Cell Biology, Disease Biomarkers

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC10A1
TargetSLC10A1
Protein SequenceSynthetic peptide located within the following region: VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY
Molecular Weight38 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

NTCP, FHCA2

Similar Products

  • SLC10A1 Rabbit Polyclonal Antibody [orb316608]

    FC,  IF,  IHC,  IHC-Fr,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • NTCP rabbit pAb Antibody [orb766977]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • SLC10A1 Rabbit Polyclonal Antibody [orb500786]

    WB

    Canine, Equine, Mouse, Rabbit, Rat

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SLC10A1/NTCP1 Rabbit Polyclonal Antibody [orb738465]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Sodium/bile acid cotransporter SLC10A1 Rabbit Polyclonal Antibody [orb76184]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SLC10A1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. SLC10A1 is modified by N-linked glycosylation.

SLC10A1 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

SLC10A1 Rabbit Polyclonal Antibody

Sample Tissue: Human MDA-MB-435s, Antibody Dilution: 1.0 ug/ml.

SLC10A1 Rabbit Polyclonal Antibody

Sample Type: HT1080, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

SLC10A1 Rabbit Polyclonal Antibody

Positive control (+): Human liver (LI), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

SLC10A1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

SLC10A1 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC10A1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003040

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SLC10A1 Rabbit Polyclonal Antibody (orb578335)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry