You have no items in your shopping cart.
Cart summary
Recombinant Mouse IL-10
Catalog Number: orb623198
Product Properties
| Catalog Number | orb623198 |
|---|---|
| Category | Proteins |
| Description | IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast. |
| Form/Appearance | Lyophilized |
| Protein Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160) |
| MW | 18.8 kDa |
| Application notes | The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control. |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Images
Similar Products
- Item 1 of 1
Mouse IL10 protein (Active) [orb359015]
> 97% as determined by SDS-PAGE and HPLC.
18.7 kDa
E.Coli
500 μg, 100 μg, 10 μg - Item 1 of 1
Mouse Il10 protein [orb594838]
Greater than 95% as determined by SDS-PAGE.
18.9 kDa
E.coli
1 mg, 500 μg, 50 μg, 10 μg Mouse IL-22 [orb2994339]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 43.8 KDa. Observed: 50-65 KDa, reducing conditions
1 mg, 500 μg, 50 μg, 10 μgMouse IL-22 [orb2995243]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
Predicted: 16.7 KDa. Observed: 15 KDa, reducing conditions
1 mg, 500 μg, 50 μg, 10 μg- Item 1 of 1
Recombinant mouse IL-10 protein, N-His (HEK293) [orb1516603]
>90% as determined by SDS-PAGE
20.6 kDa
100 μg, 500 μg, 20 μg
Reviews
Recombinant Mouse IL-10 (orb623198)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review