You have no items in your shopping cart.
Cart summary
Recombinant Mouse IL-1 beta
Catalog Number: orb623192
Product Properties
| Catalog Number | orb623192 |
|---|---|
| Category | Proteins |
| Description | IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast. |
| Form/Appearance | Lyophilized |
| Protein Sequence | VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152) |
| MW | 17.4 kDa |
| Application notes | The Mouse APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control. |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Images
Similar Products
- Item 1 of 1
Mouse IL1B protein (Active) [orb359006]
> 96% as determined by SDS-PAGE and HPLC.
17.5 kDa
E.Coli
10 μg, 100 μg, 500 μg Mouse PTX3 [orb2993117]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 43.4 KDa. Observed: 54 KDa, reducing conditions
1 mg, 10 μg, 50 μg, 500 μg- Item 1 of 1
Recombinant mouse IL-1b protein, C-His [orb1516852]
>95% as determined by SDS-PAGE
26 kDa
500 μg, 100 μg, 20 μg Recombinant Mouse CD121b/IL1R2 Protein, C-His [orb2964833]
>90% as determined by SDS-PAGE.
40.45 kDa
1 mg, 100 μg, 50 μgRecombinant Mouse IL1B/IL1F2 Protein, N-His [orb2964762]
>90% as determined by SDS-PAGE.
19.69 kDa
1 mg, 100 μg, 50 μg
Reviews
Recombinant Mouse IL-1 beta (orb623192)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review