Cart summary

You have no items in your shopping cart.

Rat Q5PPP2 protein (Active)

Catalog Number: orb359140

Select Product Size
SizePriceQuantity
5 μg$ 210.00
100 μg$ 1,350.00
500 μg$ 2,930.00
5 μg Enquire
100 μg Enquire
500 μg Enquire
DispatchUsually dispatched within 1-2 weeks
Product Properties
Catalog Numberorb359140
CategoryProteins
DescriptionRecombinant rat Q5PPP2 active protein
TagTag-Free
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Purity> 96% as determined by SDS-PAGE and HPLC.
Protein SequenceM+PTGSVTIPSSCCVTFISKKIPVNRVISYQLANGSICPKAGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV
Protein LengthPartial
UniProt IDQ5PPP2
MW10.5 kDa
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
SourceE.Coli
Biological OriginRattus norvegicus (Rat)
Biological ActivityFully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration of 50-250 ng/ml.
Expression Region23-119aa
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Research AreaImmunology & Inflammation
NoteFor research use only
Expiration Date6 months from date of receipt.
Images
Rat Q5PPP2 protein (Active)

Reviews

Rat Q5PPP2 protein (Active) (orb359140)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet