Ppargc1a Rabbit Polyclonal Antibody

• Catalog Number: orb330094
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Ppargc1a
• Target: Ppargc1a
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Ppargc1a
• Protein Sequence: Synthetic peptide located within the following region: QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGL
• UniProt ID: O70343
• MW: 90kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti A830037N07Rik antibody, anti PGC-1 antibody,
• Note: For research use only
• NCBI: NP_032930

Ppargc1a antibody - middle region (orb330094) validated by WB using Transfected Melanoma Cell at 1:1000.

WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.