PKM2 Rabbit Polyclonal Antibody

• Catalog Number: orb583715
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PKM2
• Target: PKM
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PKM2
• Protein Sequence: Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ
• UniProt ID: P11980
• MW: 58kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PK3, TCB, p58, OIP3, PKM2, CTHBP, THBP1, HEL-S-30
• Research Area: Cell Biology, Molecular Biology
• Note: For research use only
• NCBI: NP_002645

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. PKM is supported by BioGPS gene expression data to be expressed in HeLa.

WB Suggested Anti-PKM2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.