PITX3 Rabbit Polyclonal Antibody

• Catalog Number: orb329701
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PITX3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PITX3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: PITX3
• UniProt ID: O75364
• Protein Sequence: Synthetic peptide located within the following region: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPG
• NCBI: NP_005020
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CTPP4 antibody, anti MGC12766 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 293T, Antibody Dilution: 1.0 ug/mL, PITX3 is supported by BioGPS gene expression data to be expressed in HEK293T.

Immunohistochemistry with Testis tissue at an antibody concentration of 5 ug/mL using anti-PITX3 antibody (orb329701).

WB Suggested Anti-PITX3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: MCF7 cell lysate.