You have no items in your shopping cart.
MAP4K4 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MAP4K4 |
| Target | MAP4K4 |
| Protein Sequence | Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ |
| Molecular Weight | 142kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Phospho-MAP4K4 (Ser801) Rabbit Polyclonal Antibody [orb6381]
IF, IHC-Fr, IHC-P, WB
Canine, Equine, Gallus, Mouse, Rabbit
Human, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlMAP4K4 Rabbit Polyclonal Antibody [orb628628]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.

Liver

WB Suggested Anti-MAP4K4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.
Documents Download
Request a Document
Protocol Information
MAP4K4 Rabbit Polyclonal Antibody (orb580624)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review









