Cart summary

You have no items in your shopping cart.

IGF2BP2 Rabbit Polyclonal Antibody

SKU: orb330141

Description

Rabbit polyclonal antibody to IGF2BP2

Research Area

Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human IGF2BP2
TargetIGF2BP2
Protein SequenceSynthetic peptide located within the following region: QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS
Molecular Weight66kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-A170 antibody, anti-EBI 3 associated protein of 60 kDa antibody, anti-EBI 3 associated protein p60 antibody, anti-EBI3 associated protein of 60 kDa antibody, anti-EBI3 associated protein p60 antibody, anti-EBI3-associated protein of 60 kDa antibody, anti-EBIAP antibody, anti-FTDALS3 antibody, anti-MGC127197 antibody, anti-ORCA antibody, anti-OSF-6 antibody, anti-Osi antibody, anti-OSIL antibody, anti-Oxidative stress induced like antibody, anti-p60 antibody, anti-p62 antibody, anti-p62B antibody, anti-Paget disease of bone 3 antibody, anti-PDB 3 antibody, anti-PDB3 antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain p62 antibody, anti-Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-PKC-zeta-interacting protein antibody, anti-Protein kinase C-zeta-interacting protein antibody, anti-Sequestosome 1 antibody, anti-Sequestosome-1 antibody, anti-SQSTM 1 antibody, anti-SQSTM_HUMAN antibody, anti-Sqstm1 antibody, anti-STAP antibody, anti-STONE14 antibody, anti-Ubiquitin binding protein p62 antibody, anti-Ubiquitin-binding protein p62 antibody, anti-ZIP 3 antibody, anti-ZIP antibody, anti-ZIP3 antibody

Similar Products

  • IGF2-BP2 rabbit pAb Antibody [orb767404]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • IGF2BP2 Antibody [orb1320112]

    ELISA,  IF,  IHC,  WB

    Canine, Human, Monkey, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • IGF2BP2 Rabbit Polyclonal Antibody [orb627946]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • IGF2BP2 Antibody [orb672452]

    ELISA,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • IGF2BP2 Rabbit Polyclonal Antibody [orb331403]

    WB

    Human

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

IGF2BP2 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

IGF2BP2 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

IGF2BP2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

IGF2BP2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

IGF2BP2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

IGF2BP2 Rabbit Polyclonal Antibody

WB Suggested Anti-IGF2BP2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate, IGF2BP2 is supported by BioGPS gene expression data to be expressed in HT1080.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006539

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

IGF2BP2 Rabbit Polyclonal Antibody (orb330141)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry