You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb594842 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor(TNF),partial (Active) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 100 mM NaCl, pH 7.2 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Protein Length | Extracellular Domain |
| UniProt ID | P01375 |
| MW | 21.8 kDa |
| Application notes | Extracellular Domain |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 30-150 pg/ml. |
| Expression Region | 57-233aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Read more... |
| Background | Tumor Necrosis Factor-α (TNF-α) is secreted by mac Read more... |
| Research Area | Cancer Biology |
| Note | For research use only |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
FC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Greater than 93% as determined by SDS-PAGE. | |
46.6 kDa | |
Mammalian cell |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review