You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594842 |
---|---|
Category | Proteins |
Description | Recombinant Human Tumor necrosis factor(TNF),partial (Active) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 100 mM NaCl, pH 7.2 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
Protein Length | Extracellular Domain |
UniProt ID | P01375 |
MW | 21.8 kDa |
Application notes | Extracellular Domain |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 30-150 pg/ml. |
Expression Region | 57-233aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Read more... |
Background | Tumor Necrosis Factor-α (TNF-α) is secreted by mac Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 93% as determined by SDS-PAGE. | |
46.6 kDa | |
Mammalian cell |
FC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Greater than 90% as determined by SDS-PAGE. | |
19.4 kDa | |
Yeast |
ELISA, FC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |