You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human THPO protein
Catalog Number: orb604411
| Catalog Number | orb604411 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Thrombopoietin(THPO), partial |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL |
| Protein Length | Partial |
| UniProt ID | P40225 |
| MW | 34.7 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 22-195aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | C-mpl ligand Short name, ML Megakaryocyte colony-s Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human THPO protein [orb594751]
Greater than 95% as determined by SDS-PAGE.
37.3 kDa
Mammalian cell
10 μg, 50 μg, 1 mg, 500 μg - Item 1 of 1
Human TPO (N, C-6His) Protein [orb1471766]
Greater than 95% as determined by reducing SDS-PAGE.
37.3 KDa
Mammalian
10 μg, 50 μg - Item 1 of 1
Recombinant human TPO protein (Active, HEK293) [orb1817180]
> 95% as determined by SDS-PAGE
80-85 kDa
100 μg, 50 μg, 10 μg 
Human THPO protein [orb392562]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant Human THPO Protein, C-His [orb2835923]
> 90% as determined by SDS-PAGE.
38.74 kDa
100 μg, 50 μg, 20 μg
