You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human THPO protein
Catalog Number: orb594751
| Catalog Number | orb594751 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Thrombopoietin(THPO) (Active) |
| Tag | N-terminal 6xHis-tagged and C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 37.3 kDa |
| UniProt ID | P40225 |
| Protein Sequence | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG |
| Protein Length | Full Length of Mature Protein |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using MO7E human megakaryocytic leukemic cells is 0.55 ng/ml. |
| Expression Region | 22-353aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
| Alternative names | Thrombopoietin;C-mpl ligand;Megakaryocyte colony-s Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human Thrombopoietin Protein [orb867314]
Unconjugated
95%
35.6 kDa
Human Thrombopoietin, premium grade (orb867314) is expressed from human 293 cells (HEK293). It contains AA Ser 22 - Gly 353 (Accession # P40225-1).
1 mg, 50 μg, 20 μg - Item 1 of 1
Human TPO (N, C-6His) Protein [orb1471766]
Greater than 95% as determined by reducing SDS-PAGE.
37.3 KDa
Mammalian
10 μg, 50 μg - Item 1 of 1
Human THPO protein [orb604411]
Greater than 85% as determined by SDS-PAGE.
34.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Recombinant human TPO protein (Active, HEK293) [orb1817180]
> 95% as determined by SDS-PAGE
80-85 kDa
100 μg, 50 μg, 10 μg 
Human THPO protein [orb392562]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg
