You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CEACAM6 protein
Catalog Number: orb383282
| Catalog Number | orb383282 |
|---|---|
| Category | Proteins |
| Description | Recombinant human CEACAM6 protein. |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P40199 |
| MW | 47.2 kDa |
| Application notes | E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 35-320aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Non-specific crossreacting antigen, Normal cross-r Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human CEACAM6 Protein [orb1476703]
Greater than 95% as determined by SDS-PAGE.
32.6 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 2
Human CEACAM6 Protein, His Tag [orb1173762]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 32.1 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM6-His is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg 
Human CEACAM6 ELISA Kit [orb405954]
Human
0.83 ng/mL-20 ng/mL
0.33 ng/mL
24 T, 48 T, 96 T, 10 x 96 T, 5 x 96 THuman CEACAM6(233-319) Protein, hFc Tag [orb2668306]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 35.6 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM6(233-319)-hFc is approximately 35-70 kDa due to glycosylation.
100 μg, 50 μg, 10 μgHuman CEACAM6(143-239) Protein, hFc Tag [orb2668307]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 36.7 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM6(143-239)-hFc is approximately 35-70 kDa due to glycosylation.
50 μg, 10 μg, 100 μg
