You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1476703 |
---|---|
Category | Proteins |
Description | Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6(CEACAM6)(Active) |
Tag | C-terminal 10xHis-tagged |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG |
Protein Length | Full Length of Mature Protein |
UniProt ID | P40199 |
MW | 32.6 kDa |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Human CEACAM8, the EC50 is 144.7-223.8 ng/mL.②Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody, the EC50 is 0.9430-1.377 ng/mL. |
Expression Region | 35-320aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | (Non-specific crossreacting antigen)(Normal cross- Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Human CEACAM8, the EC50 is 144.7-223.8 ng/mL.
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody, the EC50 is 0.9430-1.377 ng/mL.
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 32.1 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM6-His is approximately 35-55 kDa due to glycosylation. | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
47.2 kDa | |
E.coli |
Human | |
0.83 ng/mL-20 ng/mL | |
0.33 ng/mL |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 35.6 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM6(233-319)-hFc is approximately 35-70 kDa due to glycosylation. |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 36.7 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM6(143-239)-hFc is approximately 35-70 kDa due to glycosylation. |