You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human CD274 protein
Catalog Number: orb605286
| Catalog Number | orb605286 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Programmed cell death 1 ligand 1(CD274),partial |
| Tag | C-terminal hFc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 52.7 kDa |
| UniProt ID | Q9NZQ7 |
| Protein Sequence | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody, the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL. |
| Expression Region | 19-238aa |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Alternative names | PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1) Read more... |
| Note | For research use only |
| Application notes | Extracellular Domain |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody, the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.
The purity of CD274 was greater than 90% as determined by SEC-HPLC.
- Item 1 of 4
Human PD-L1 Protein, mFc-His tag [orb689384]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 52.3 kDa after removal of the signal peptide.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 5
Recombinant human PD-L1 protein, C-His (HEK293) [orb1516352]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 35-42 kDa based on Tris-Bis PAGE result.
100 μg - Item 1 of 4
Recombinant human PD-L1 protein, C-mFc (HEK293) [orb1516351]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 63-68 kDa based on Tris-Bis PAGE result.
100 μg - Item 1 of 2
Human PD-L1 Protein, His Tag [orb257752]
Unconjugated
98%
26.0 kDa
Human PD-L1, His Tag (orb257752) is expressed from human 293 cells (HEK293). It contains AA Phe 19 - Arg 238 (Accession # NP_054862.1 ).
1 mg, 100 μg - Item 1 of 3
Human PD-L1 Protein, Fc Tag [orb257754]
Unconjugated
95%
51.3 kDa
Human PD-L1, Fc Tag (orb257754) is expressed from human 293 cells (HEK293). It contains AA Phe 19 - Arg 238 (Accession # NP_054862.1).
1 mg, 100 μg
