You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human BDNF protein
Catalog Number: orb603933
| Catalog Number | orb603933 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Brain-derived neurotrophic factor(BDNF),partial |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | ELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC |
| Protein Length | Partial |
| UniProt ID | P23560 |
| MW | 38.5 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 137-237aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Abrineurin |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 5
- Item 1 of 3
Human pro-BDNF Protein [orb1471731]
Greater than 95% as determined by reducing SDS-PAGE.
25.6 KDa
Mammalian
10 μg, 50 μg - Item 1 of 1
Human BDNF protein [orb246302]
Greater than 90% as determined by SDS-PAGE.
29.5 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human BDNF protein [orb594732]
Greater than 95% as determined by SDS-PAGE.
13 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human/Murine/Rat BDNF Protein [orb1471779]
Greater than 95% as determined by reducing SDS-PAGE.
13 KDa
Mammalian
10 μg, 50 μg
