GRHL2 Rabbit Polyclonal Antibody

• Catalog Number: orb577218
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRHL2
• Target: GRHL2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRHL2
• Protein Sequence: Synthetic peptide located within the following region: VEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMESMVEGFKVTLME
• UniProt ID: Q6ISB3
• MW: 71 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BOM, ECTDS, PPCD4, DFNA28, TFCP2L3
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• NCBI: NP_079191
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): MCF7 (N10), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.

Rabbit Anti-GRHL2 Antibody, Paraffin Embedded Tissue: Human Brain, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-GRHL2 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate.