Fto Rabbit Polyclonal Antibody

• Catalog Number: orb330511
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Fto
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep, Yeast
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: Fto
• UniProt ID: Q8BGW1
• Protein Sequence: Synthetic peptide located within the following region: MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV
• NCBI: NP_036066
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AW743446 antibody, anti mKIAA1752 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

FTO was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb330511 with 1:200 dilution. Western blot was performed using orb330511 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FTO IP with orb330511 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-Fto Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Mouse Brain.