Fbxw7 Rabbit Polyclonal Antibody

• Catalog Number: orb576309
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Fbxw7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Fbxw7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 70kDa
• Target: Fbxw7
• UniProt ID: Q8VBV4
• Protein Sequence: Synthetic peptide located within the following region: GIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKG
• NCBI: NP_536353
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: A, AGO, Cdc4, Fbw7, SEL-, Fbwd6, Fbx30, Fbxo3, Fbx
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Mouse Brain

WB Suggested Anti-Fbxw7 Antibody Titration: 0.2-1 ug/ml, Positive Control: Mouse Lung.