ARL13B Rabbit Polyclonal Antibody

• Catalog Number: orb330698
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARL13B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL13B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48 kDa
• Target: ARL13B
• UniProt ID: Q8TCL5
• Protein Sequence: Synthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
• NCBI: NP_659433
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ARL2L1 antibody, anti DKFZp686E2075 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The 49 kDa peptide is also present in 37 kDa isoforms. The protein may be modified by lipidation and/or sumoylation.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Positive control (+): Lung tumor (T-LU), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-ARL13B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.