IMPDH1 monoclonal antibody (M01), clone 3G6

• Catalog Number: orb2292717
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant IMPDH1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3G6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: IMPDH1 (NP_000874, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDC
• NCBI: NP_000874
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged IMPDH1 is approximately 0.03 ng/ml as a capture antibody.

IMPDH1 monoclonal antibody (M01), clone 3G6 Western Blot analysis of IMPDH1 expression in Hela S3 NE.

IMPDH1 monoclonal antibody (M01), clone 3G6. Western Blot analysis of IMPDH1 expression in HeLa.

Western Blot detection against Immunogen (36.74 KDa).