You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292726 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant IL8. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein. |
Protein Sequence | EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
Tested applications | ELISA, IP, WB |
Clone Number | 4G11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH13615 |
IL8 monoclonal antibody, clone 4G11 (Cat # orb2292726). Western Blot detection against a 8.9 KDa biologically active recombinant human IL-8 (endothelial-derived).
Immunoprecipitation of IL8 transfected lysate using anti-IL8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL8 MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (31.69 KDa).