IL8 monoclonal antibody (M12), clone 4G11

• Catalog Number: orb2292726
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant IL8.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4G11
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein.
• Conjugation: Unconjugated
• Protein Sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
• NCBI: AAH13615
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

IL8 monoclonal antibody, clone 4G11 (Cat # orb2292726). Western Blot detection against a 8.9 KDa biologically active recombinant human IL-8 (endothelial-derived).

Immunoprecipitation of IL8 transfected lysate using anti-IL8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL8 MaxPab rabbit polyclonal antibody.

Western Blot detection against Immunogen (31.69 KDa).