IL7 (Human) Recombinant Protein (P01)

• Catalog Number: orb2288377
• Category: Proteins
• Description: Human IL7 full-length ORF ( AAH47698, 26 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
• Clonality: Recombinant
• Tag: GST
• Buffer/Preservatives: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Protein Sequence: DCDIEGKDGKQYESVLVVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
• Tested applications: AP, Array, ELISA, WB
• Application notes: Best use within three months from the date of receipt of this protein.
• Antibody Type: Recombinant Antibody
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Note: For research use only
• NCBI: AAH47698