You have no items in your shopping cart.
Cart summary
IL6RA Peptide - C-terminal region
Catalog Number: orb1997938
| Catalog Number | orb1997938 |
|---|---|
| Category | Proteins |
| Description | IL6RA Peptide - C-terminal region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| MW | 50 kDa |
| UniProt ID | P22272 |
| Protein Sequence | Synthetic peptide located within the following region: PPYSLGPLKPTFLLVPLLTPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDY |
| NCBI | NP_034689.2 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | Il6r, CD126, IL-6R, IL-6RA, IL-6R-alpha Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
