You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292727 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human IL6 protein. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | IL6 (AAH15511, 1 a.a. ~ 212 a.a) full-length human protein. |
Protein Sequence | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Tested applications | IF, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH15511 |
Immunofluorescence of purified MaxPab antibody to IL6 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of IL6 expression in transfected 293T cell line by IL6 MaxPab polyclonal antibody. Lane 1: IL6 transfected lysate (23.32 KDa). Lane 2: Non-transfected lysate.