IL1RAPL1 monoclonal antibody (M04), clone 1C10

• Catalog Number: orb2291436
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant IL1RAPL1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1C10
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: IL1RAPL1 (NP_055086.1, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMES
• NCBI: NP_055086.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged IL1RAPL1 is approximately 0.3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.74 KDa).