IL1B monoclonal antibody (M01), clone 2A8

• Catalog Number: orb2292729
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant IL1B.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: IL1B (AAH08678, 170 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: DKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Tested applications: ELISA, IF, IP, WB
• Clone Number: 2A8
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH08678

Detection limit for recombinant GST tagged IL1B is approximately 10 ng/ml as a capture antibody.

IL1B monoclonal antibody (M01), clone 2A8. Western Blot analysis of IL1B expression in human liver.

Immunofluorescence of monoclonal antibody to IL1B on HeLa cell. [antibody concentration 10 ug/ml]

Immunoprecipitation of IL1B transfected lysate using anti-IL1B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL1B MaxPab rabbit polyclonal antibody.

Western Blot detection against Immunogen (36.63 KDa).