IL13RA2 monoclonal antibody (M01), clone 2E10

• Catalog Number: orb2292723
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant IL13RA2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E10
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: IL13RA2 (NP_000631, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET
• NCBI: NP_000631
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged IL13RA2 is approximately 0.1 ng/ml as a capture antibody.

IL13RA2 monoclonal antibody (M01), clone 2E10. Western Blot analysis of IL13RA2 expression in HeLa.

Western Blot analysis of IL13RA2 expression in transfected 293T cell line by IL13RA2 monoclonal antibody (M01), clone 2E10. Lane 1: IL13RA2 transfected lysate (44.176 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of IL13RA2 over-expressed 293 cell line, cotransfected with IL13RA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with IL13RA2 monoclonal antibody (M01), clone 2E10 (Cat # orb2292723). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).